26 Court St
Brooklyn, NY 11242
Rausher Daniel is the owner of this property.
We have found 10 residents at 26 Court St, Brooklyn, NY 11242.
In the zip code 11242 monthly rental for a studio unit is around $1,710, monthly rental for a one-bed unit is $1,750 and for two-bed unit is $2,000.
Residents
| Name | Age | Phone Number | Details |
|---|---|---|---|
| Jose L Cruz SR | 67 | (718) 443-4888 | Details |
| Ana J Estevez | N/A | (347) 365-7722 | Details |
| Jay R Berman | 77 | (718) 441-9596 | Details |
| Charles Finkelstein | 59 | (718) 855-4755 | Details |
| Frank Castro | 87 | (718) 256-3405 | Details |
| Jennifer L Wolfe | 51 | (347) 405-5644 | Details |
| Amy Weinstock Slavin | N/A | (718) 783-4084 | Details |
| Lee A Fine | 57 | (516) 295-5441 | Details |
| David Avid Cohen | 32 | (347) 725-5546 | Details |
| Rosa E Cohen | 62 | (718) 913-0361 | Details |
Business Registered At This Address
| Company Name | Connected Person | Industry | Sector | Phone |
|---|---|---|---|---|
| Pollard and Koenig LLC | James Koenig | Legal Services (Services) | Legal Services | |
| Ira Greene | Ira Greene | Legal Services (Services) | Legal Services | Male |
| Advanced Management Service | Steven Kramer | 718-852-5310 | ||
| Ella Harris | Ella Harris | Social Services (Services) | Individual And Family Services | Female |
| Phyllis Schwartz | Phyllis Schwartz | Social Services (Services) | Individual And Family Services | 7182372131 |
| Cheryl Solomon | Cheryl Solomon | Legal Services (Services) | Legal Services | Female |
| Adrian Ellis Law Office | Adrian Ellis | Legal Services (Services) | Legal Services | Male |
| Jacqueline Miller | Jacqueline Miller | Health Services (Services) | Offices Of Health Practitioner | Female |
| MANGO CAPITAL, INC. | ANTHONY C HAYES | |||
| MANGO CAPITAL, INC. | ANTHONY C HAYES | |||
| MANGO CAPITAL, INC. | ANTHONY C HAYES | |||
| MANGO CAPITAL, INC. | ANTHONY C HAYES | |||
| Northern Ann C | Monique Moore | Legal Services (Services) | Legal Services | |
| Hill & Rosenberg | Andrea Hill | Legal Services (Services) | Legal Services | Female |
| Skye Wilson | Skye Wilson | Health Services (Services) | Offices Of Health Practitioner | 7182439039 |
| Gelb & Black PC | Andrew Black | Legal Services (Services) | Legal Services | male |
| Vincent L Johnson | Vincent Johnson | Legal Services (Services) | Legal Services | |
| Bergan & Walsh | Joseph Walsh | Legal Services (Services) | Legal Services | Male |
| Bergan & Walsh | Joseph Walsh | Legal Services (Services) | Legal Services | male |
| Jeffrey Peters PC | Jeffrey Peters | Legal Services (Services) | Legal Services | Male |
| Pamela Roth | Pamela Roth | Legal Services (Services) | Legal Services | 7188020707 |
| Pamela S Roth | Pamela Roth | Legal Services (Services) | Legal Services | 7188029025 |
| Francis L Giordano | Francis Giordano | Legal Services (Services) | Legal Services | male |
| Steven Kaye Assoc | Steven Kaye | Legal Services (Services) | Legal Services | 7182221000 |
| Juan Rivera | Juan Rivera | Legal Services (Services) | Legal Services | 7188550071 |
| Juan Rivera Law Office | Juan Rivera | Legal Services (Services) | Legal Services | 7188550071 |
| Tonya Curtis | Tonya Curtis | Legal Services (Services) | Legal Services | 7185965812 |
| Stern Bryk & Hoffman | Trudy Stern | Legal Services (Services) | Legal Services | 7186255430 |
| Tucker, Jordan | Tucker Jordan | 718-875-4805 | ||
| Feinsilver Law Group | David Feinsilver | Legal Services (Services) | Legal Services | Male |
| Blannor Realty Llc's | Marc Goldstein | 718-625-7799 | ||
| reportamerica.com | robert keating | 516-682-6800 | ||
| Jack Baum Esq | Jack Baum | Legal Services (Services) | Legal Services | male |
| Jack Baum Law Offices | Jack Baum | Legal Services (Services) | Legal Services | Male |
| Jeffrey Kramer | Jeffrey Kramer | Legal Services (Services) | Legal Services | Male |
| Law Offices of Longo & DApice | Mark Longo | Legal Services (Services) | Legal Services | 7188555684 |
| Michael Good | Michael Good | Legal Services (Services) | Legal Services | 7188524612 |
| Mark A.Longo | Giordano Anthony | 17188555684 | ||
| Santillo & Ferreira PC | Daniel Ferreira | Legal Services (Services) | Legal Services | |
| Long Time No See Corp | Ira Miller | Legal Services (Services) | Legal Services | |
| Joseph Marcus | Joseph Marcus | Legal Services (Services) | Legal Services | male |
| Michael Troiano Attorney | Michael Troiano | Legal Services (Services) | Legal Services | 7188587100 |
| Signature Bank | Mala Sharma | Depository Institutions (Credit) | National Commercial Banks | 7182901860 |
| Allison Weinstein | Allison Weinstein | Suburban, Local Transit and Interurban Highway Passenger Transport (Transportation) | Local Passenger Transportation, Nec | Female |
| Neal Foreman | Neal Foreman | Legal Services (Services) | Legal Services | 7186254423 |
| One Way Deli | Robert Caravello | Food Stores (Food) | Grocery Stores | 7187971393 |
| Alan Levin | Alan Levin | Legal Services (Services) | Legal Services | Male |
| Peter Cohen PHD | Peter Cohen | Health Services (Services) | Offices Of Health Practitioner | 7188525540 |
| Kenneth Gellerman | Kenneth Gellerman | Legal Services (Services) | Legal Services | 7187973737 |
| Kenneth Gellerman | Kenneth Gellerman | Legal Services (Services) | Legal Services | 7187973737 |
| Norman Kaufman Esq | Norman Kaufman | Legal Services (Services) | Legal Services | |
| Sharda Enterprises Inc | Ashvin Patel | Miscellaneous Retail (Stores) | Stationery Stores | 7186251184 |
| Law Office of Paulette Taylor | Paulette Taylor | Legal Services (Services) | Legal Services | |
| Immigrant's Journal Legal | Laverne Henry | Publishing, Allied and Printing Industries (Industries) | Newspapers | Female |
| Herbert Douglas Esq | Herbert Douglas | Legal Services (Services) | Legal Services | male |
| Press & Herbert | Douglas Herbert | Legal Services (Services) | Legal Services | 7182465727 |
| Mitchell Friedman Esq | Mitchell Friedman | Legal Services (Services) | Legal Services | |
| Kings County Criminal Bar Assn | Paul Battiste | Legal Services (Services) | Legal Services | |
| Antioco Peter M40 | Peter Antioco | Legal Services (Services) | Legal Services | male |
| Seth Rubenstein PC | Seth Rubenstein | Legal Services (Services) | Legal Services | 7186241084 |
| Seth Rubenstein PC | Seth Rubenstein | Legal Services (Services) | Legal Services | 7186241084 |
| Micheal T Sucher | Michael Sucher | Legal Services (Services) | Legal Services | 7185221995 |
| Angelyn Johnson & John Lewis | Angelyn Johnson | Legal Services (Services) | Legal Services | Female |
| Angelyn Johnson Attorney | Angelyn Johnson | Legal Services (Services) | Legal Services | female |
| Carib Books | Paul Clement | 7185963234 | ||
| Utopia Home Care Inc | Manny Martinez | Health Services (Services) | Home Health Care Services | 7182469233 |
| Giuffre & Kaplan | John Giuffre | Legal Services (Services) | Legal Services | Male |
| Darren Fields | Darren Fields | Legal Services (Services) | Legal Services | Male |
| Neil M Schneider Attorney | Neil Schneider | Legal Services (Services) | Legal Services | |
| Brooklyn Physicians IPA Inc | Paul Conlin | Health Services (Services) | Offices And Clinics Of Medical Doctors | male |
| Martin Price | Martin Price | Legal Services (Services) | Legal Services | |
| Elizabeth Fee | Elizabeth Fee | Legal Services (Services) | Legal Services | Female |
| Watts & Watts Ltd | Gregory Watts | Legal Services (Services) | Legal Services | 7188755020 |
| John Gutman | John Gutman | Legal Services (Services) | Legal Services | Male |
| John Gutman | John Gutman | Legal Services (Services) | Legal Services | male |
| Lewis T Alden | Alden Lewis | Legal Services (Services) | Legal Services | |
| Rosenberg Musso Weiner | Bruce Weiner | Legal Services (Services) | Legal Services | 7188556840 |
| Randolph Kraft Esq | Randolph Kraft | Legal Services (Services) | Legal Services | |
| D & V Legal Advertising | Donald Leung | Legal Services (Services) | Legal Services | Male |
| D & V Legal Advertising LLC | Donald Leung | Business Services (Services) | Advertising Agencies | male |
| Frank C McDermott | Frank McDermott | Legal Services (Services) | Legal Services | male |
| One Way Deli | Vincent Caravello | Food Stores (Food) | Grocery Stores | |
| Salzman & Salzman | Richard Salzman | Legal Services (Services) | Legal Services | 7186242394 |
| Gelb & Black | James Gelb | Legal Services (Services) | Legal Services | Male |
| Isaac Capital Enterprise Corp | Quinn Isaac | Real Estate (Housing) | Real Estate Agents And Managers | |
| Fine & Hallock | Lee Fine | Legal Services (Services) | Legal Services | Male |
| Mhra I-Chap | Laura Weinberger | Engineering, Management, Accounting, Research and Related Industries (Services) | Noncommercial Research Organizations | 7188525249 |
| 26 Operating Corp | Joseph Schachter | Real Estate (Housing) | Real Estate Agents And Managers | male |
| Patricia Parkinson CRC | Patricia Parkinson | Health Services (Services) | Offices Of Health Practitioner | |
| Headley Trevor & Associates | Trevor Headley | Legal Services (Services) | Legal Services | male |
| Rudy Brown | Rudy Brown | Legal Services (Services) | Legal Services | 7182220688 |
| Robert Musso Attorney | Robert Musso | Legal Services (Services) | Legal Services | 7182379059 |
| Karl Franklin | Karl Franklin | Legal Services (Services) | Legal Services | 7188751850 |
| Karl Franklin | Karl Franklin | Legal Services (Services) | Legal Services | 7188751850 |
| Carol Levantrosser | Carol Levantrosser | Health Services (Services) | Offices Of Health Practitioner | Female |
| Rose & Koerner Esquire | Ronald Koerner | Legal Services (Services) | Legal Services | |
| Gilbert Parris Lawyer | Gilbert Parris | Legal Services (Services) | Legal Services | Male |
| Donald Weiss | Donald Weiss | Legal Services (Services) | Legal Services | Male |
| Michelle & Weiss | Donald Weiss | Legal Services (Services) | Legal Services | 7185969122 |
| Ginsberg Saltiel & Greene | Steven Ginsberg | Real Estate (Housing) | Real Estate Agents And Managers | male |
| Cadillac Grill Bbq Llc | Danny Best | 718-254-0900 | ||
| Stuart Rubin Esq | Stuart Rubin | Legal Services (Services) | Legal Services | |
| Central Medical Svc-Westrock | Michael Hearns | Health Services (Services) | Health And Allied Services, Nec | Male |
| Steven Z Mostofsky PC | Steven Mostofsky | Legal Services (Services) | Legal Services | |
| Serena Rosario Law Offices | Serena Rosario | Legal Services (Services) | Legal Services | 7186940304 |
| Advanced Management | Robert Alper | Engineering, Management, Accounting, Research and Related Industries (Services) | Management Services | Male |
| Butler Plaza Condominium | Robert Alper | Real Estate (Housing) | Apartment Building Operators | male |
| Advanced Management Service | Robert Alper | 718-852-5310 | ||
| New Beginnings Counseling Svc | Pierre Tribaudi | Social Services (Services) | Individual And Family Services | 7188559162 |
| Tribaudi Pierre Csw | Pierre Tribaudi | Social Services (Services) | Individual And Family Services | |
| Cypress Best Burgers | David Parke | 718-254-0900 | ||
| Messinger Jules G | Charles Rock | Legal Services (Services) | Legal Services | |
| Alexander T Singer | Alexander Singer | Legal Services (Services) | Legal Services | male |
| Gerard Nolan Attorney | Gerard Nolan | Legal Services (Services) | Legal Services | Male |
| Gary Farrell | Gary Farrell | Legal Services (Services) | Legal Services | male |
| Burton Gelfand | Burton Gelfand | Legal Services (Services) | Legal Services | male |
| Gelfand Gelfand & Yavne | Burton Gelfand | Legal Services (Services) | Legal Services | Male |
| Blannor Realty Llc's | Blanche Goldstein | 718-625-7799 | ||
| Dominick Salvati & Son Arch | Anthony Salvati | Engineering, Management, Accounting, Research and Related Industries (Services) | Architectural Services | Male |
| Daniel E Rausher Esq Attorney | Daniel Rausher | Legal Services (Services) | Legal Services | |
| Alex Shulman Law Office | Alex Shulman | Legal Services (Services) | Legal Services | Male |
| Adrien Ellis | Adrien Ellis | Legal Services (Services) | Legal Services | female |
| Career Transition Resources | Debra Laks | Social Services (Services) | Job Training And Related Services | Female |
| Emanuel Greenwald | Emanuel Greenwald | Legal Services (Services) | Legal Services | Male |
| Alter & Barbaro | Bernard Alter | Legal Services (Services) | Legal Services | male |
| Gregory Nanton | Gregory Nanton | Legal Services (Services) | Legal Services | Male |
| S.J. Carroll Jr. Inc. | Carrol David | 718 852 0051 | ||
| Jerome KARP Law Offices | Jerome Karp | Legal Services (Services) | Legal Services | Male |
| Jerome Karp PC | Jerome Karp | Legal Services (Services) | Legal Services | male |
| Jacques O Tuchler & Associates | Doris Silber | Real Estate (Housing) | Real Estate Agents And Managers | female |
| Tuchler & Assoc | Doris Silber | Business Services (Services) | Business Services, Nec | 7186252080 |
| Tulip Mark E Attorney At Law | Mark Tulip | Legal Services (Services) | Legal Services | |
| Norman Turk | Norman Turk | Legal Services (Services) | Legal Services | 7186436810 |
| Turk Norman Attorney At Law | Norman Turk | Legal Services (Services) | Legal Services | 7186436810 |
| Press & Herbert | Elliot Press | Legal Services (Services) | Legal Services | |
| George J Fortunato | George Fortunato | Engineering, Management, Accounting, Research and Related Industries (Services) | Management Consulting Services | male |
| Medi-Tech International Corp | George Fortunato | Watches and Clocks, Measurement, Analyzer and Control Instruments, and Photo and Medical Goods (Products) | Surgical Appliances And Supplies | |
| Carl Husbands Law Office | Carl Husbands | Legal Services (Services) | Legal Services | Male |
| Husbands Carl Attorney At Law | Carl Husbands | Legal Services (Services) | Legal Services | male |
| Michael Aizin | Michael Aizin | Legal Services (Services) | Legal Services | |
| Anthony A Caronna | Anthony Caronna | Legal Services (Services) | Legal Services | male |
| Jerome P Mandel PC | Jerome Mandel | Legal Services (Services) | Legal Services | male |
| Harvey Kupferberg | Harvey Kupferberg | Legal Services (Services) | Legal Services | Male |
| Plimpton David PHD | Barbara Thacher | Health Services (Services) | Offices Of Health Practitioner | |
| first computers & electronics inc. | israel rubin | 212-683-2140 | ||
| I Singer Esq | Irving Singer | Legal Services (Services) | Legal Services | male |
| Singer Block & Matles PC | Irving Singer | Legal Services (Services) | Legal Services | 7188584140 |
| Edelstein Faegenburg & Brown | Saul Edelstein | Legal Services (Services) | Legal Services | Male |
| Edelsteins Seagenburg Brown PH | Saul Edelstein | Legal Services (Services) | Legal Services | male |
| Elliot Green Law Office | Elliot Green | Legal Services (Services) | Legal Services | Male |
| Hewitt Vivienne | Vivienne Hewitt | Legal Services (Services) | Legal Services | female |
| Gerber & Gerber | Ethan Gerber | Legal Services (Services) | Legal Services | Male |
| Jim Grossman | Jim Grossman | Insurance Brokers, Agents and Services (Insurance) | Insurance Agents, Brokers, And Service | male |
| Early Intervention | Denise Goodsell | Engineering, Management, Accounting, Research and Related Industries (Services) | Noncommercial Research Organizations | Female |
| Mounier Paralegal Svc | David Mounier | Business Services (Services) | Business Services, Nec | 7186430380 |
| Amabiles & Erman | Carl Erman | Legal Services (Services) | Legal Services | male |
| Sussman-Dickman Tax Service | Adelle Sussman | Personal Services (Services) | Tax Return Preparation Services | |
| John Janusas | John Janusas | Legal Services (Services) | Legal Services | Male |
| Golden Development & Cnstr | Anthony Clouden | Building Construction - Operative Builders and General Contractors (Construction) | Nonresidential Construction, Nec | male |
| Golden Development & Constr | Anthony Clouden | Engineering, Management, Accounting, Research and Related Industries (Services) | Management Services | Male |
| Philip Skittone | Philip Skittone | Legal Services (Services) | Legal Services | 7187979039 |
| Reibman & Weiner | Marc Reibman | Legal Services (Services) | Legal Services | 7185221743 |
| Samuel Weinbaum | Samuel Weinbaum | Legal Services (Services) | Legal Services | 7182370500 |
| Glyne Harper | Glyne Harper | Legal Services (Services) | Legal Services | Male |
| Diversified Inch By Inch Inc | Decosta Headley | Building Construction - Operative Builders and General Contractors (Construction) | Nonresidential Construction, Nec | |
| McMickens Jcqueline Assoc Pllc | Jacqueline McMickens | Legal Services (Services) | Legal Services | 7185964877 |
| Glendoval J Stephens | Glendoval Stephens | Legal Services (Services) | Legal Services | |
| Alter & Barbaro | Mitch Alter | Legal Services (Services) | Legal Services | Male |
| Denise Costanza | Denise Costanza | Legal Services (Services) | Legal Services | Female |
| Denise Costanza Dgn Atty | Denise Costanza | Legal Services (Services) | Legal Services | female |
| Santillo & Ferreira | Keith Santillo | Legal Services (Services) | Legal Services | 7185221024 |
| Fleet | Sal Monaco | Depository Institutions (Credit) | State Commercial Banks | male |
| Sheila K Maron Attorney | Sheila Maron | Legal Services (Services) | Legal Services | |
| Hecht & Hecht | Ephrem Hecht | Legal Services (Services) | Legal Services | Male |
| Halpern Brown & Darienzo | John Darienzo | Legal Services (Services) | Legal Services | male |
| Halpern Brown Darienzo | John Darienzo | Legal Services (Services) | Legal Services | Male |
| Yvonne Beckles Expediting Svc | Yvonne Beckles | Air Transportation (Transportation) | Air Courier Services | 7188555031 |
| Raymond A Raskin | Raymond Raskin | Legal Services (Services) | Legal Services | 7188752060 |
| Raymond Raskin | Raymond Raskin | 718-875-2060 | ||
| Blannor Realty Co | Ronald Haraka | Real Estate (Housing) | Real Estate Agents And Managers | Male |
| Frederic A Nicholson | Frederic Nicholson | Legal Services (Services) | Legal Services | male |
| Laurence L Rothstein | Laurence Rothstein | Legal Services (Services) | Legal Services | |
| Irene Zelterman Lscw | Irene Zelterman | Social Services (Services) | Individual And Family Services | Female |
Property Records At This Address
| Street Address | Parcel ID | Owner | Land Use | Total Value |
|---|---|---|---|---|
| 26 Court Street | 6101003002500001 | 26 COURT ASSOCIATES L | Tower Type | $33,934,500 |
| 26 Court Street | 6101003074410059 | RAUSHER DANIEL | Attached or Semi-Detatched | $31,351 |
Domains Registered At This Address
| Domain | Owner | Registrar | Creation Date |
|---|---|---|---|
| 25plaza.net | Peters, Thomas | NETWORK SOLUTIONS, LLC. | 2008-03-05 |
| tpeters.net | Peters, Thomas | NETWORK SOLUTIONS, LLC. | 2010-12-22 |
| brooklyncerebralpalsylawyer.com | Marc Chase | GODADDY.COM, LLC | 2004-03-05 |
| nassaumedicalmalpracticelawyers.com | Marc Chase | GODADDY.COM, LLC | 2009-10-14 |
| newyorkinfantbraindamagelawyer.com | Marc Chase | GODADDY.COM, LLC | 2004-03-05 |
| newyorkautoaccidentlawfirm.com | Marc Chase | GODADDY.COM, LLC | 2004-03-05 |
| newyorkcaraccidentlawfirm.com | Marc Chase | GODADDY.COM, LLC | 2004-03-05 |
| newyorkcatastrophicinjurylawfirm.com | Marc Chase | GODADDY.COM, LLC | 2004-03-05 |
| newyorknegligencelawfirm.com | Marc Chase | GODADDY.COM, LLC | 2004-03-05 |
| newyorkestateplanninglawfirm.com | Marc Chase | GODADDY.COM, LLC | 2004-03-05 |
| brooklynbirthinjurylawyer.com | Marc Chase | GODADDY.COM, LLC | 2004-03-05 |
| newyorkwrongfuldeathlawfirm.com | Marc Chase | GODADDY.COM, LLC | 2004-03-05 |
| newyorkmedicalmalpracticelawfirm.com | Marc Chase | GODADDY.COM, LLC | 2004-03-05 |
| newyorkchildbraindamagelawyer.com | Marc Chase | GODADDY.COM, LLC | 2004-03-05 |
| newyorkcoopapartmentpurchase.com | Marc Chase | GODADDY.COM, LLC | 2004-03-05 |
| newyorkcondominiumapartmentpurchase.com | Marc Chase | GODADDY.COM, LLC | 2004-03-05 |
| newyorkcondopurchase.com | Marc Chase | GODADDY.COM, LLC | 2004-03-05 |
| newyorkhousepurchase.com | Marc Chase | GODADDY.COM, LLC | 2004-03-05 |
| newyorkcooperativeapartmentpurchase.com | Marc Chase | GODADDY.COM, LLC | 2004-03-05 |
| newyorkrealestatelawfirm.com | Marc Chase | GODADDY.COM, LLC | 2004-03-05 |
| suffolkmedicalmalpractice.com | Chase Marc | GODADDY.COM, LLC | 2002-10-11 |
| nassaumedicalmalpractice.com | Chase Marc | GODADDY.COM, LLC | 2002-10-11 |
| brooklynaccidents.com | Chase Marc | GODADDY.COM, LLC | 2004-02-26 |
| suffolkaccidents.com | Chase Marc | GODADDY.COM, LLC | 2004-03-02 |
| customeyezableformzandpaymant.com | PATRICIA HODGE | MELBOURNE IT, LTD. D/B/A INTERNET NAMES WORLDWIDE | 2013-05-31 |
| halelawpartners.com | Paul Hale | GODADDY.COM, LLC | 2008-03-22 |
| tsaclassaction.com | paul hale | MELBOURNE IT, LTD. D/B/A INTERNET NAMES WORLDWIDE | 2010-11-17 |
| nycbikelawyer.com | Paul Hale | WILD WEST DOMAINS, LLC | 2011-04-23 |
| pyropetnics.com | Solomon, Cheryl | NETWORK SOLUTIONS, LLC. | 2010-07-04 |
| pyropetnics.net | Solomon, Cheryl | NETWORK SOLUTIONS, LLC. | 2010-07-04 |
| tfsbillpay.com | PATRICK SCHAEFER | ENOM, INC. | 2011-02-15 |
| politipets.com | Jordan Tucker | GODADDY.COM, LLC | 2010-09-11 |
| scroodle.com | Jordan Tucker | WILD WEST DOMAINS, LLC | 2005-07-18 |
| politicats.com | Jordan Tucker | GODADDY.COM, LLC | 2010-09-11 |
| aquafreak.com | Jordan Tucker | GODADDY.COM, LLC | 2008-11-10 |
| michaeljgoodlaw.com | Michael Good | WILD WEST DOMAINS, LLC | 2009-10-20 |
| longislandpersonalinjurylawyer.com | Chase Mark | GODADDY.COM, LLC | 2004-03-11 |
| longislandpersonalinjury.com | Chase Mark | GODADDY.COM, LLC | 2001-05-02 |
| brooklyncaraccidents.com | Chase Mark | GODADDY.COM, LLC | 2004-02-26 |
| brooklynautoaccidents.com | Chase Mark | GODADDY.COM, LLC | 2004-02-26 |
| brooklynpersonalinjurylawyers.com | Chase Mark | GODADDY.COM, LLC | 2004-02-08 |
| brooklynmedicalmalpracticeattorneys.com | Chase Mark | GODADDY.COM, LLC | 2004-02-26 |
| longislandinjuryattorneys.com | Chase Mark | GODADDY.COM, LLC | 2005-02-04 |
| nassaucaraccident.com | Chase Mark | GODADDY.COM, LLC | 2004-03-02 |
| nassauaccident.com | Chase Mark | GODADDY.COM, LLC | 2004-03-02 |
| nassauaccidents.com | Chase Mark | GODADDY.COM, LLC | 2004-03-02 |
| nassauautoaccidents.com | Chase Mark | GODADDY.COM, LLC | 2004-03-02 |
| nassauautoaccident.com | Chase Mark | GODADDY.COM, LLC | 2004-03-02 |
| longislandcaraccidents.com | Chase Mark | GODADDY.COM, LLC | 2004-03-01 |
| longislandautoaccidents.com | Chase Mark | GODADDY.COM, LLC | 2004-03-01 |
| nassaucaraccidents.com | Chase Mark | GODADDY.COM, LLC | 2004-03-02 |
| brooklynbuprenorphine.com | William Rush | 1 & 1 INTERNET AG | 2013-07-29 |
| guardianshipqueens.com | Ira Miller | GODADDY.COM, LLC | 2013-01-22 |
| guardianshipbrooklyn.com | Ira Miller | GODADDY.COM, LLC | 2013-01-22 |
| guardianshiprichmondcounty.com | Ira Miller | GODADDY.COM, LLC | 2013-01-22 |
| guardianship5boroughs.com | Ira Miller | GODADDY.COM, LLC | 2013-01-22 |
| guardianshipmanhattan.com | Ira Miller | GODADDY.COM, LLC | 2013-01-22 |
| guardianshipkingscounty.com | Ira Miller | GODADDY.COM, LLC | 2013-01-22 |
| guardianshipnewyorkcounty.com | Ira Miller | GODADDY.COM, LLC | 2013-01-22 |
| guardianshipstatenisland.com | Ira Miller | GODADDY.COM, LLC | 2013-01-22 |
| guardianshipnassaucounty.com | Ira Miller | GODADDY.COM, LLC | 2013-01-22 |
| edfriedmanlaw.com | Edward Friedman | DOMAIN.COM, LLC | 2010-08-05 |
| sjdiamondesq.com | Stewart Diamond | TUCOWS DOMAINS INC. | 2013-04-19 |
| ssdisabilityappealslawyer.com | Stewart Diamond | GODADDY.COM, LLC | 2011-12-06 |
| ssalawyer.com | Michael Troiano | REGISTER.COM, INC. | 2000-03-16 |
| paulamsimpsonesq.com | Paula Simpson | GODADDY.COM, LLC | 2013-02-08 |
| msaleemlaw.com | Mohammad Saleem | 1 & 1 INTERNET AG | 2012-01-09 |
| dnislaw.com | MOHAMMAD SALEEM | NETWORK SOLUTIONS, LLC. | 2013-08-03 |
| gregespolaw.com | Gregory Esposito | GODADDY.COM, LLC | 2013-04-11 |
| casewin.net | meltzer, stuart | NETWORK SOLUTIONS, LLC. | 2013-01-28 |
| crimesq.com | stuart meltzer | DOMAIN.COM, LLC | 2013-09-17 |
| lawyer1.biz | stuart meltzer | NETWORK SOLUTIONS INC. | 2013-01-29 |
| sethrubenstein.com | Seth Rubenstein | MELBOURNE IT, LTD. D/B/A INTERNET NAMES WORLDWIDE | 2004-08-05 |
| legalnyc.com | Michael Sucher | GODADDY.COM, LLC | 2001-03-18 |
| nycounsel.com | Michael Sucher | GODADDY.COM, LLC | 2001-10-28 |
| yourhampton.com | Michael Sucher | GODADDY.COM, LLC | 2004-01-29 |
| police-brutality-lawyernyc.com | matthew flamm | WILD WEST DOMAINS, LLC | 2011-05-20 |
| nybankruptcy.biz | Bruce Weiner | GODADDY.COM, INC. | 2010-12-01 |
| dvlegal.com | Donald Leung | MELBOURNE IT, LTD. D/B/A INTERNET NAMES WORLDWIDE | 2003-12-21 |
| elissaspernschwartz.com | Elissa Schwartz | GODADDY.COM, LLC | 2008-07-03 |
| douglasgrankinlaw.com | Douglas Rankin | REGISTER.COM, INC. | 2010-03-31 |
| adlerandkarliner.com | JEFF ADLER | DOMAINPEOPLE, INC. | 2003-06-23 |
| trimobilephone.com | Daniel Reznik | GODADDY.COM, LLC | 2008-10-28 |
| newyorkcitypersonalinjurylawyersfirm.com | Steven Weiner | GODADDY.COM, LLC | 2010-02-26 |
| bronxconstructionaccidentlawyersfirm.com | Steven Weiner | GODADDY.COM, LLC | 2010-02-26 |
| brooklynconstructionaccidentlawyersfirm.com | Steven Weiner | GODADDY.COM, LLC | 2010-02-26 |
| bronxlawyersfirm.com | Steven Weiner | GODADDY.COM, LLC | 2010-02-26 |
| bronxmedicalmalpracticelawyersfirm.com | Steven Weiner | GODADDY.COM, LLC | 2010-02-26 |
| brooklynmedicalmalpracticelawyersfirm.com | Steven Weiner | GODADDY.COM, LLC | 2010-02-26 |
| headinjurylawyersfirm.com | Steven Weiner | GODADDY.COM, LLC | 2010-10-21 |
| queensscaffoldaccidentlawyer.com | Steven Weiner | GODADDY.COM, LLC | 2010-10-21 |
| queensscaffoldaccident.com | Steven Weiner | GODADDY.COM, LLC | 2010-10-21 |
| eileenkaplanlaw.com | EILEEN KAPLAN | ENOM, INC. | 2012-03-05 |
| globaldiningproject.com | Michael Coulombre | GODADDY.COM, LLC | 2011-07-16 |
| suenwin.com | Robert Renna | WILD WEST DOMAINS, LLC | 2005-12-10 |
| rennalaw.com | Robert Renna | WILD WEST DOMAINS, LLC | 2005-12-10 |
| evictionlawyernyc.com | steven ginsberg | GODADDY.COM, LLC | 2011-06-06 |
| evictionlawyernyc.net | steven ginsberg | GODADDY.COM, LLC | 2011-06-06 |
| affordablenewyorkattorney.com | George Gilmer | 1 & 1 INTERNET AG | 2013-09-29 |
| acsdefenselawyerny.com | George Gilmer | WILD WEST DOMAINS, LLC | 2013-08-16 |
| whatisanuncontestddivorce.com | George Gilmer | WILD WEST DOMAINS, LLC | 2013-08-19 |
| how-can-i-get-an-uncontested-or-no-fault-divorce-in-new-york.com | George Gilmer | 1 & 1 INTERNET AG | 2012-07-03 |
| affordablenewyorkattorney.info | George Gilmer | 1&1 Internet AG (R113-LRMS) | 2013-09-29 |
| affordablenewyorkattorney.net | George Gilmer | 1 & 1 INTERNET AG | 2013-09-29 |
| pacrimtradinginc.com | DAVID LEFKOWITZ | ENOM, INC. | 2012-08-20 |
| stuartrubindefenselawyer.com | Stuart Rubin | GODADDY.COM, LLC | 2009-03-23 |
| criminaldefensebrooklyn.com | Stuart Rubin | GODADDY.COM, LLC | 2009-03-23 |
| mostofskys.com | Steven Mostofsky | 1 & 1 INTERNET AG | 2012-03-18 |
| debralaks.com | DEBRA LAKS | REGISTER.COM, INC. | 2009-02-18 |
| kungfuschoolnyc.com | Julie Schwartzman | WILD WEST DOMAINS, LLC | 2013-10-23 |
| kungfuclassesny.com | Julie Schwartzman | WILD WEST DOMAINS, LLC | 2012-10-15 |
| judithangel.com | Julie Schwartzman | WILD WEST DOMAINS, LLC | 2009-07-14 |
| kungfuschoolsny.com | Julie Schwartzman | WILD WEST DOMAINS, LLC | 2013-10-23 |
| courtstreetbrooklyn.com | Julie Schwartzman | WILD WEST DOMAINS, LLC | 2012-02-28 |
| northskykungfu.com | Julie Schwartzman | WILD WEST DOMAINS, LLC | 2011-05-19 |
| kungfuschoolny.com | Julie Schwartzman | WILD WEST DOMAINS, LLC | 2013-10-23 |
| clasesdekungfuny.com | Julie Schwartzman | WILD WEST DOMAINS, LLC | 2012-10-15 |
| couplesfitnyc.com | Sharon Doldron | GODADDY.COM, LLC | 2013-09-09 |
| ltattorneys.com | Michael Sagginario | MELBOURNE IT, LTD. D/B/A INTERNET NAMES WORLDWIDE | 2005-07-19 |
| gbsnyc.com | Pearl Phillip | GODADDY.COM, LLC | 2009-12-14 |
| afyamag.com | Pearl Phillip | GODADDY.COM, LLC | 2011-01-21 |
| thepowderroom.net | Pearl Phillip | GODADDY.COM, LLC | 2009-10-14 |
| husbandslaw.com | CARL HUSBANDS | NETWORK SOLUTIONS, LLC. | 2005-07-12 |
| moshesimoncpa.com | Moshe Simon | GODADDY.COM, LLC | 2011-06-23 |
| moishesimoncpa.com | Moshe Simon | GODADDY.COM, LLC | 2011-06-23 |
| lawofficesofjuanrivera.com | Jaun Rivera | REGISTER.COM, INC. | 2004-09-20 |
| msxrealtygroup.com | Michael Silber | HOSTOPIA.COM INC. D/B/A APLUS.NET | 2005-01-31 |
| nycdivorcenow.com | Sally Markowitz | GODADDY.COM, LLC | 2010-06-03 |
| propaneoutboard.com | Irwin Tucker | GODADDY.COM, LLC | 2011-08-01 |
| goldendevco.com | Anthony Clouden | DOMAIN.COM, LLC | 2012-04-12 |
| biz4bill.info | Anthony Clouden | GoDaddy.com, LLC (R171-LRMS) | 2013-05-08 |
| biz4bill.net | Anthony Clouden | GODADDY.COM, LLC | 2013-05-08 |
| legality4kindness.com | angelicque moreno | GODADDY.COM, LLC | 2011-07-20 |
| mylegalityforhumanity.com | angelicque moreno | GODADDY.COM, LLC | 2011-07-20 |
| legality4humankind.com | angelicque moreno | GODADDY.COM, LLC | 2011-07-20 |
| legalityforhumanitysite.com | angelicque moreno | GODADDY.COM, LLC | 2011-07-20 |
| legalityforhumanitynow.com | angelicque moreno | GODADDY.COM, LLC | 2011-07-20 |
| legality4humanity.com | angelicque moreno | GODADDY.COM, LLC | 2011-07-20 |
| legalityforhumanity.com | angelicque moreno | GODADDY.COM, LLC | 2011-07-20 |
| legalityforpeople.com | angelicque moreno | GODADDY.COM, LLC | 2011-07-20 |
| legalityforhumanitystore.com | angelicque moreno | GODADDY.COM, LLC | 2011-07-20 |
| legality4people.com | angelicque moreno | GODADDY.COM, LLC | 2011-07-20 |
| legality-for-people.com | angelicque moreno | GODADDY.COM, LLC | 2011-07-20 |
| legalityforhumanityshop.com | angelicque moreno | GODADDY.COM, LLC | 2011-07-20 |
| legalityforhumanitys.com | angelicque moreno | GODADDY.COM, LLC | 2011-07-20 |
| legality4mankind.com | angelicque moreno | GODADDY.COM, LLC | 2011-07-20 |
| thelegalityforhumanity.com | angelicque moreno | GODADDY.COM, LLC | 2011-07-20 |
| freelegalityforhumanity.com | angelicque moreno | GODADDY.COM, LLC | 2011-07-20 |
| avanzinomoreno.com | angelicque moreno | GODADDY.COM, LLC | 2011-07-20 |
| legalityforhumanitytoday.com | angelicque moreno | GODADDY.COM, LLC | 2011-07-20 |
| legalityforhumanityblog.com | angelicque moreno | GODADDY.COM, LLC | 2011-07-20 |
| newlegalityforhumanity.com | angelicque moreno | GODADDY.COM, LLC | 2011-07-20 |
| legalityforhumanityonline.com | angelicque moreno | GODADDY.COM, LLC | 2011-07-20 |
| legality4humanrace.com | angelicque moreno | GODADDY.COM, LLC | 2011-07-20 |
| legalityformankind.com | angelicque moreno | GODADDY.COM, LLC | 2011-07-20 |
| legality-for-humanity.com | angelicque moreno | GODADDY.COM, LLC | 2011-07-20 |
| bestlegalityforhumanity.com | angelicque moreno | GODADDY.COM, LLC | 2011-07-20 |
| legality-for-mankind.com | angelicque moreno | GODADDY.COM, LLC | 2011-07-20 |
| avanzinomoreno.biz | angelicque moreno | GODADDY.COM, INC. | 2011-07-20 |
| legalityforhumanity.biz | angelicque moreno | GODADDY.COM, INC. | 2011-07-20 |
| avanzinomoreno.info | angelicque moreno | GoDaddy.com, LLC (R171-LRMS) | 2011-07-20 |
| legalityforhumanity.info | angelicque moreno | GoDaddy.com, LLC (R171-LRMS) | 2011-07-20 |
| kinchlawgroup.com | Cheryl Kinch | GODADDY.COM, LLC | 2008-03-05 |
| kinchlawfirm.com | Cheryl Kinch | GODADDY.COM, LLC | 2007-07-10 |
| exclusivepronet.com | Emmanuel Roy | REGISTER.COM, INC. | 2008-05-02 |
| kestenbauminjurylaw.com | Jeffrey Kestenbaum | WILD WEST DOMAINS, LLC | 2012-08-31 |
| brooklyn-accidentlaw.com | Jeffrey Kestenbaum | WILD WEST DOMAINS, LLC | 2012-03-03 |
| sucherlaw.com | Danielle SUCHER | GANDI SAS | 2007-02-01 |
| daniellesucher.com | Danielle SUCHER | GANDI SAS | 2010-05-04 |
| betterthanag.com | Danielle SUCHER | GANDI SAS | 2013-08-07 |
| indexofclaims.com | Danielle Sucher | GANDI SAS | 2009-11-30 |
| injurylawbrooklyn.com | PAUL AJLOUNY | ENOM, INC. | 2012-06-01 |
| hbdlawoffice.com | John Darienzo | GODADDY.COM, LLC | 2009-03-10 |
| foreverun.com | gerard marzocchi | GODADDY.COM, LLC | 2013-08-29 |
| mechanicsondemand.com | gerard marzocchi | GODADDY.COM, LLC | 2013-10-10 |
| plumberondemand.com | gerard marzocchi | GODADDY.COM, LLC | 2013-10-10 |
| gotnerdstv.com | gerard marzocchi | GODADDY.COM, LLC | 2013-07-02 |
| nycorganicseo.com | gerard marzocchi | GODADDY.COM, LLC | 2013-08-02 |
| inhomemovietheater.com | gerard marzocchi | GODADDY.COM, LLC | 2013-08-02 |
| nycgotnerds.com | gerard marzocchi | GODADDY.COM, LLC | 2013-08-03 |
| nerdsgotseo.com | gerard marzocchi | GODADDY.COM, LLC | 2013-08-03 |
| organoaide.com | gerard marzocchi | GODADDY.COM, LLC | 2013-08-28 |
| technologybusinesssolution.com | gerard marzocchi | GODADDY.COM, LLC | 2013-08-01 |
| thecreativestruggle.com | gerard marzocchi | GODADDY.COM, LLC | 2013-05-31 |
| itandbusinessconsulting.com | gerard marzocchi | GODADDY.COM, LLC | 2013-08-01 |
| buildmyappnow.com | gerard marzocchi | GODADDY.COM, LLC | 2013-08-03 |
| wlocinc.com | gerard marzocchi | GODADDY.COM, LLC | 2013-06-21 |
| worldslargestoilcompany.com | gerard marzocchi | GODADDY.COM, LLC | 2013-06-21 |
| inhousetutor.com | gerard marzocchi | GODADDY.COM, LLC | 2013-08-23 |
| got-nerd.com | gerard marzocchi | GODADDY.COM, LLC | 2013-05-10 |
| brooklynheightsproduction.com | gerard marzocchi | GODADDY.COM, LLC | 2013-06-13 |
| brooklynitsupport.com | gerard marzocchi | GODADDY.COM, LLC | 2013-07-31 |
| gotnerdtv.com | gerard marzocchi | GODADDY.COM, LLC | 2013-07-02 |
| organaraide.com | gerard marzocchi | GODADDY.COM, LLC | 2013-08-08 |
| dailydoseinspiration.com | gerard marzocchi | GODADDY.COM, LLC | 2013-08-10 |
| seogotnerds.com | gerard marzocchi | GODADDY.COM, LLC | 2013-08-03 |
| organarade.com | gerard marzocchi | GODADDY.COM, LLC | 2013-08-08 |
| gotnerds.com | gerard marzocchi | GODADDY.COM, LLC | 2003-06-04 |
| joemurejr.com | gerard marzocchi | GODADDY.COM, LLC | 2012-04-18 |
| brooklynheightsproductions.com | gerard marzocchi | GODADDY.COM, LLC | 2013-06-13 |
| organorade.com | gerard marzocchi | GODADDY.COM, LLC | 2013-08-08 |
| brooklynatty.com | Roger Archibald | GODADDY.COM, LLC | 2009-12-25 |
| aquaindus.com | Roger Archibald | GODADDY.COM, LLC | 2012-09-10 |
| pier44antiques.com | Roger Archibald | GODADDY.COM, LLC | 2013-11-04 |
| eldercarenyc.org | Irene Zelterman | GoDaddy.com, LLC (R91-LROR) | 2007-04-06 |
Vehicle Sales At This Address
| Name | Car | Year | VIN |
|---|---|---|---|
| GEORGE FORTUNATO | LEXUS RX 350 | 2010 | JTJBK1BA9A2402312 |
| MARK LONGO | LEXUS RX 450H | 2010 | JTJBC1BA7A2413175 |
| RAWLE NEWTON | BMW 5 SERIES | 2008 | WBANV93588CW55212 |
| MICHAEL SUCHER | TOYOTA PRIUS | 2010 | JTDKN3DU9A0122365 |
| ANTHONY CARONNA | MERCEDES-BENZ E-CLASS | 2008 | WDBUF56X28B213824 |
| ALEXANDER SINGER | LEXUS RX 350 | 2010 | 2T2BK1BA8AC061646 |
| ALEXANDER SINGER | LEXUS GS 350 | 2010 | JTHCE1KS1A0027937 |
| TERRY ENGLISH | JEEP LIBERTY | 2010 | 1J4PN2GK0AW129870 |
| DAMION BROWN | TOYOTA SIENNA | 2012 | 5TDYK3DC1CS208358 |
| JAY COHEN | FORD MUSTANG | 2007 | 1ZVHT82H675242832 |
| ANTHONY CLOUDEN | BMW 7 SERIES | 2010 | WBAKC6C59ACL67793 |
| ANTHONY MARANDO | MERCEDES-BENZ CLS-CLASS | 2007 | WDDDJ72X47A082553 |
| ETHAN GERBER | AUDI S4 | 2010 | WAUDGAFL6AA090252 |
Also on Court St, Brooklyn
| Street Address | Owner | Details |
|---|---|---|
| 26 Court St, Brooklyn | Rausher Daniel | Details |
| 545 Court St, Brooklyn | Sj Hamilton Rlty Co I | Details |
| 508 Court St, Brooklyn | Tai Tung Trading Corp | Details |
| 203 Court St, Brooklyn | Ahmed M Mused | Details |
| 190 Court St, Brooklyn | NA | Details |
| 183 Court St, Brooklyn | NA | Details |
| 178 Court St, Brooklyn | Antonio Magagnini Rev | Details |
| 125 Court St, Brooklyn | 125 Court St Condomin | Details |
| 453 Court St, Brooklyn | Gavigan John M | Details |
| 195 Court St, Brooklyn | Lily Jalinos Livingtr | Details |